1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. Animal-Free IL-25/IL-17E Protein, Human (His)

Animal-Free IL-25/IL-17E Protein, Human (His)

Cat. No.: HY-P700116AF
Handling Instructions Technical Support

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. Animal-Free IL-25/IL-17E Protein, Human (His) is the recombinant human-derived animal-FreeIL-25/IL-17E protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. Animal-Free IL-25/IL-17E Protein, Human (His) is the recombinant human-derived animal-FreeIL-25/IL-17E protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The cytokine Animal-Free IL-25/IL-17E, produced by various cells such as eosinophils, T-helper type 2 (Th2) cells, or epithelial cells, plays a crucial role in the internal safety of adaptive immune responses by regulating cytokine production. This cytokine promotes and augments T-helper type 2 responses both locally and systemically, acting through its receptor composed of IL17RA and IL17RB for signal transduction. Upon binding, Animal-Free IL-25 activates the JAK2-STAT5A pathway, leading to the secretion of type-2-associated cytokines, including IL4, IL9, and IL13. Additionally, it induces the release of IL8 and IL6 from eosinophils by simultaneously activating the MAPK and NF-kappa-B pathways. Notably, Animal-Free IL-25 inhibits the differentiation of T-helper (Th17) cells through the production of IL4, IL5, and IL13, contributing to its regulatory role in immune responses.

Biological Activity

1.Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <5 ng/mL.
2.Measure by its ability to induce CXCL1 secretion in HT29 cells. The ED50 for this effect is <1 ng/mL

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9H293-1 (Y33-G177)

Gene ID
Molecular Construction
N-term
IL-17E (Y33-G177)
Accession # Q9H293-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Predicted Molecular Mass
17.7 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-25/IL-17E Protein, Human (His)
Cat. No.:
HY-P700116AF
Quantity:
MCE Japan Authorized Agent: