1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-24
  5. Animal-Free IL-24 Protein, Mouse (His)

IL-24 Protein, a crucial immune regulatory cytokine, plays a pivotal role in modulating immune responses. Animal-Free IL-24 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-24 Protein, a crucial immune regulatory cytokine, plays a pivotal role in modulating immune responses. Animal-Free IL-24 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-24, also known as Interleukin-24, is a crucial immune regulatory cytokine that plays a pivotal role in modulating immune responses. This protein is involved in regulating various aspects of the immune system, including inflammation and anti-tumor responses. IL-24 is known for its diverse functions, such as inducing apoptosis (programmed cell death) in cancer cells while sparing normal cells, making it a promising candidate for cancer therapy. Additionally, IL-24 has anti-inflammatory properties and contributes to the regulation of immune cell activities.

Biological Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <0.3 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

A0A0R4J1N5 (Q27-L181)

Gene ID

93672

Molecular Construction
N-term
IL-24 (Q27-L181)
Accession # A0A0R4J1N5
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-24; IL-4-induced secreted protein; Melanoma differentiation-associated gene 7 protein (MDA-7); Th2-specific cytokine FISP; Il24; Mda7
AA Sequence

MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Predicted Molecular Mass
18.9 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-24 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-24 Protein, Mouse (His)
Cat. No.:
HY-P700200AF
Quantity:
MCE Japan Authorized Agent: