Animal-Free IL-2 Protein, Pig (His)

IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

IL-2 is a receptor cytokine produced by activated CD4-positive helper T cells and plays its role by activating JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 binds to receptor complexes consisting of high affinity trimers IL-2R (IL2RA/CD25, IL2RB/CD122 and IL2RG/CD132) or low affinity dimers IL-2R (IL2RB and IL2RG). IL-2 can increase the cytolytic activity of NK cells. Promote strong proliferation of activated B cells and immunoglobulin production. IL-2 is involved in the differentiation and homeostasis of effector T cell subsets, including Th1, Th2, Th17, and memory CD8-positive T cells. IL-2 synthesis is strictly regulated by TCR and CD28 signaling at the mRNA level. It mediates the activation-induced cell death (AICD) process. IL-2 can be used in the research of cancer immunotherapy^[1][2][3][4].

Measure by its ability to induce proliferation in CTLL2 cells. The ED₅₀ for this effect is < 0.5 ng/mL.

Pig

E. coli

C-6*His

P26891(A21-T154)

396868  [NCBI]

Full Length of Mature Protein

MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. G Reya T, et al. Thymic stromal-cell abnormalities and dysregulated T-cell development in IL-2-deficient mice. Dev Immunol. 1998;5(4):287-302.  [Content Brief]

  [2]. Zhu J, et al. Stat5 activation plays a critical role in Th2 differentiation. Immunity. 2003 Nov;19(5):739-48.  [Content Brief]

  [3]. Smith GA, et al. Essential biphasic role for JAK3 catalytic activity in IL-2 receptor signaling. Nat Chem Biol. 2016 May;12(5):373-9.  [Content Brief]

  [4]. Sim GC, et al. The IL-2 cytokine family in cancer immunotherapy. Cytokine Growth Factor Rev. 2014 Aug;25(4):377-90.  [Content Brief]