1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-38
  5. Animal-Free IL-1F10/IL-38 Protein, Mouse (His)

Animal-Free IL-1F10/IL-38 Protein, Mouse (His)

Cat. No.: HY-P700213AF
Handling Instructions Technical Support

IL-1F10/IL-38 proteins regulate immune responses. Animal-Free IL-1F10/IL-38 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1F10/IL-38 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
2 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1F10/IL-38 proteins regulate immune responses. Animal-Free IL-1F10/IL-38 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1F10/IL-38 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-1F10/IL-38 Protein, exhibiting immunomodulatory activity, operates by influencing cytokine production. While it does not independently induce cytokine production, it plays a regulatory role in the immune response. Notably, IL-1F10/IL-38 reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans, indicating its ability to modulate specific immune pathways. Moreover, it diminishes IL36G-induced production of IL8 by peripheral blood mononuclear cells, highlighting its broader impact on cytokine responses. Conversely, IL-1F10/IL-38 increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS), suggesting its involvement in diverse immune processes. Functioning as a ligand for IL-36R/IL1RL2, IL-1F10/IL-38 engages in intricate interactions, and its binding with the cargo receptor TMED10 facilitates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), leading to subsequent secretion.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8R459 (M1-R152)

Gene ID
Molecular Construction
N-term
IL-38 (M1-R152)
Accession # Q8R459
His
C-term
Protein Length

Full Length

Synonyms
interleukin 1 family; member 10; IL1F10
AA Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Molecular Weight

Approximately 17.89 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free IL-1F10/IL-38 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-1F10/IL-38 Protein, Mouse (His)
Cat. No.:
HY-P700213AF
Quantity:
MCE Japan Authorized Agent: