1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. Animal-Free IL-17A Protein, Human (His)

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. Animal-Free IL-17A Protein, Human (His) is the recombinant human-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. Animal-Free IL-17A Protein, Human (His) is the recombinant human-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The IL-17A Protein is a vital effector cytokine in both innate and adaptive immune responses, playing a crucial role in antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC heterodimeric receptor complex, it triggers downstream signaling pathways, resulting in the transcriptional activation of immune-related genes and potential strong immune inflammation. As a signature effector cytokine of Th17 cells, it induces neutrophil activation and recruitment at infection sites, contributing to host defense against extracellular bacteria and fungi. Additionally, the heterodimer participates in germinal center formation, mediates chemotaxis, and plays a significant role in epithelial barrier maintenance during homeostasis and infection. It forms homodimers and heterodimers, showcasing its versatility in orchestrating diverse immune processes. The IL-17A Protein emerges as a key player in connecting T cell-mediated adaptive immunity with acute inflammatory responses, highlighting its multifaceted role in immune regulation and cellular homeostasis.

Biological Activity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <6 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q16552 (I20-A155)

Gene ID
Molecular Construction
N-term
IL-17A (I20-A155)
Accession # Q16552
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
AA Sequence

MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predicted Molecular Mass
16.5 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17A Protein, Human (His)
Cat. No.:
HY-P700104AF
Quantity:
MCE Japan Authorized Agent: