Animal-Free IL-12 beta Protein, Human (His)

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. This product is for cell culture use only.

IL-12 beta Protein, a multifunctional cytokine, serves as a growth factor for activated T and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces the production of IFN-gamma by resting peripheral blood mononuclear cells (PBMC). When combined with IL23A, it forms the heterodimeric cytokine IL-23, which plays a pivotal role in both innate and adaptive immunity. This cytokine acts by binding to a receptor complex consisting of IL12RB1 and IL23R, initiating the Jak-Stat signaling cascade. Notably, IL-23 preferentially activates memory T-cells over naive T-cells and fosters the production of pro-inflammatory cytokines. The association of IL-23 with autoimmune inflammation suggests its potential involvement in autoimmune inflammatory diseases and underscores its significance in tumorigenesis.

Human

E. coli

His

P29460 (I23-S328)

3593  [NCBI]

Full Length of Mature Protein

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Approximately 35.64 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.