1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. Animal-Free IL-12 beta Protein, Human (His)

Animal-Free IL-12 beta Protein, Human (His)

Cat. No.: HY-P700100AF
Handling Instructions Technical Support

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. This product is for cell culture use only.

Background

IL-12 beta Protein, a multifunctional cytokine, serves as a growth factor for activated T and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces the production of IFN-gamma by resting peripheral blood mononuclear cells (PBMC). When combined with IL23A, it forms the heterodimeric cytokine IL-23, which plays a pivotal role in both innate and adaptive immunity. This cytokine acts by binding to a receptor complex consisting of IL12RB1 and IL23R, initiating the Jak-Stat signaling cascade. Notably, IL-23 preferentially activates memory T-cells over naive T-cells and fosters the production of pro-inflammatory cytokines. The association of IL-23 with autoimmune inflammation suggests its potential involvement in autoimmune inflammatory diseases and underscores its significance in tumorigenesis.

Species

Human

Source

E. coli

Tag

His

Accession

P29460 (I23-S328)

Gene ID
Synonyms
Interleukin-12 subunit beta; IL-12B; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40; IL-12 subunit p40; NK cell stimulatory factor chain 2; NKSF2; IL12B; NKSF2
AA Sequence

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Molecular Weight

Approximately 35.64 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-12 beta Protein, Human (His)
Cat. No.:
HY-P700100AF
Quantity:
MCE Japan Authorized Agent: