1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 3/IL-28B
  6. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His)

Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His)

Cat. No.: HY-P700204AF
Handling Instructions Technical Support

The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

IFN-lambda 3/IL-28B Protein is a cytokine that exhibits antiviral, antitumour, and immunomodulatory properties. It plays a crucial role in the host defense against viruses, particularly in epithelial tissues. This protein acts as a ligand for the IL10RB and IFNLR1 receptor complex, leading to the activation of the JAK/STAT signaling pathway and the expression of IFN-stimulated genes (ISG) that contribute to the antiviral state. Its receptor is primarily expressed in epithelial cells, which explains its cell type-selective action. Although it may not be essential for early host defense in vaginal infections, it plays a significant role in Toll-like receptor (TLR)-induced antiviral defense and the immune defense in the intestinal epithelium. Furthermore, IFN-lambda 3/IL-28B Protein also exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.

Biological Activity

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <20 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8CGK6 (D20-V193)

Gene ID
Molecular Construction
N-term
IFN-λ3 (D20-V193)
Accession # Q8CGK6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFN-λ3; IFL-1; INF-l; Interferon lambda-3; IFN-lambda-3; IL-28B; Ifnl3
AA Sequence

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV

Molecular Weight

Approximately 20.56 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His)
Cat. No.:
HY-P700204AF
Quantity:
MCE Japan Authorized Agent: