Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His)

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

IFN-lambda 2/IL-28A Protein, a versatile cytokine, exhibits antiviral, antitumoral, and immunomodulatory activities, playing a crucial role in antiviral host defense, primarily within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor, consisting of IL10RB and IFNLR1, its receptor engagement initiates the JAK/STAT signaling pathway, resulting in the expression of IFN-stimulated genes (ISG) that establish an antiviral state. With a confined receptor distribution, it predominantly operates in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it assumes a significant role in Toll-like receptor (TLR)-induced antiviral defense and plays a crucial part in the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 2/IL-28A exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, contributing to its impact on immune responses.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <2 ng/mL.

Mouse

E. coli

C-6*His

AAX58714.1 (D20-V193)

330496  [NCBI]

Partial

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.