1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 1 IFN-alpha 13
  6. Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His)

Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His)

Cat. No.: HY-P700089AF
Handling Instructions Technical Support

IFN-alpha 1a/IFNA1 Protein, produced by macrophages, demonstrates robust antiviral activities. It stimulates essential enzymes—a protein kinase and an oligoadenylate synthetase—contributing to the intricate molecular response that fortifies the host's immune defenses against viral threats. Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-alpha 1a/IFNA1 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-alpha 1a/IFNA1 Protein, produced by macrophages, demonstrates robust antiviral activities. It stimulates essential enzymes—a protein kinase and an oligoadenylate synthetase—contributing to the intricate molecular response that fortifies the host's immune defenses against viral threats. Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-alpha 1a/IFNA1 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

IFN-alpha 1a/IFNA1 Protein, originating from macrophages, exhibits potent antiviral activities. Its key function lies in the stimulation of two critical enzymes—a protein kinase and an oligoadenylate synthetase. This intricate molecular response, orchestrated by IFN-alpha 13, plays a crucial role in fortifying the host's immune defenses against viral threats.

Biological Activity

Measure by its ability to inhibit IL-8 secretion in human PBMCs in the presence of LPS. The ED50 for this effect is <1.12 μg /mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P01562 (C24-E189)

Gene ID

3439  [NCBI]/3447  [NCBI]

Molecular Construction
N-term
His
IFNA1 (C24-E189)
Accession # P01562
C-term
Synonyms
Leukocyte Interferon; IFNA1; B cell Interferon; Type I Interferon; Interferon alpha-1/13; IFN-alpha-1/13; LeIF D; IFNA1a; IFNA13
AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Molecular Weight

Approximately 20.19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-alpha 1/IFNA13 Protein, Human (His)
Cat. No.:
HY-P700089AF
Quantity:
MCE Japan Authorized Agent: