1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. I-TAC/CXCL11
  6. Animal-Free I-TAC/CXCL11 Protein, Pig (His)

Animal-Free I-TAC/CXCL11 Protein, Pig (His)

Cat. No.: HY-P700233AF
Handling Instructions Technical Support

I-TAC/CXCL11 Protein exhibits broad expression, notably in the lung (RPKM 3.0), mixtures (RPKM 2.0), and seven other tissues. This widespread distribution suggests its integral role in diverse physiological processes across different organ systems, underscoring the protein's significance in various biological contexts. Animal-Free I-TAC/CXCL11 Protein, Pig (His) is the recombinant pig-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

I-TAC/CXCL11 Protein exhibits broad expression, notably in the lung (RPKM 3.0), mixtures (RPKM 2.0), and seven other tissues. This widespread distribution suggests its integral role in diverse physiological processes across different organ systems, underscoring the protein's significance in various biological contexts. Animal-Free I-TAC/CXCL11 Protein, Pig (His) is the recombinant pig-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

I-TAC/CXCL11 Protein displays a widespread expression pattern, evident in various tissues, including the lung (RPKM 3.0), mixtures (RPKM 2.0), and seven additional tissues. This broad distribution suggests its potential involvement in diverse physiological processes across different organ systems, emphasizing the protein's significance in various biological contexts.

Species

Pig

Source

E. coli

Tag

N-His

Accession

B3GDY9 (F22-V100)

Gene ID
Molecular Construction
N-term
His
CXCL11 (F22-V100)
Accession # B3GDY9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine 11; Beta-R1; H174; IP-9; SCYB11
AA Sequence

FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV

Molecular Weight

Approximately 9.72 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free I-TAC/CXCL11 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free I-TAC/CXCL11 Protein, Pig (His)
Cat. No.:
HY-P700233AF
Quantity:
MCE Japan Authorized Agent: