1. Recombinant Proteins
  2. Immune Checkpoint Proteins Animal-free Recombinant Proteins
  3. Inhibitory Checkpoint Molecules
  4. Galectin-9
  5. Animal-Free Galectin-9/LGALS9 Protein, Human (His)

Animal-Free Galectin-9/LGALS9 Protein, Human (His)

Cat. No.: HY-P700082AF
Handling Instructions Technical Support

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Animal-Free Galectin-9/LGALS9 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-9/LGALS9 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Animal-Free Galectin-9/LGALS9 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-9/LGALS9 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).

Biological Activity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is <3 μg/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

O00182-2 (A2-T323)

Gene ID
Molecular Construction
N-term
His
LGALS9 (A2-T323)
Accession # O00182-2
C-term
Synonyms
G-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
AA Sequence

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Weight

Approximately 36.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free Galectin-9/LGALS9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Galectin-9/LGALS9 Protein, Human (His)
Cat. No.:
HY-P700082AF
Quantity:
MCE Japan Authorized Agent: