Animal-Free Galectin-7/LGALS7 Protein, Human (His)

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Animal-Free Galectin-7/LGALS7 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-7/LGALS7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Galectin-7, also known as LGALS7, is a protein potentially involved in critical cell-cell and/or cell-matrix interactions essential for normal growth control. Functioning as a pro-apoptotic protein, Galectin-7 operates intracellularly upstream of JNK activation and cytochrome c release, suggesting its role in apoptotic pathways. It exists as a monomer, and its involvement in cellular interactions and apoptotic processes underscores its significance in regulating cell growth and survival. Understanding the functions of Galectin-7 provides valuable insights into the intricate molecular mechanisms governing normal cellular processes and apoptotic signaling.

Measure by its ability to chemoattract human THP1 cells. Chemotactic activity was observed at a concentration of 0.5 μg/mL.

Human

E. coli

N-His

P47929 (S2-F136)

3963  [NCBI]

Partial

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Approximately 15.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose or PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.