1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-9
  6. Animal-Free FGF-9 Protein, Human (His)

The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

FGF-9 Protein assumes a pivotal role in governing embryonic development, cell proliferation, differentiation, and migration. Its involvement extends to diverse processes, including glial cell growth and differentiation during development, gliosis in the brain's repair and regeneration after injury, differentiation and survival of neuronal cells, and the promotion of growth in glial tumors. Operating as a monomer or homodimer, FGF-9 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for diverse cellular responses. The binding affinity between FGF-9 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors. These interactions underscore the multifaceted and indispensable role of FGF-9 in orchestrating crucial cellular events across various physiological contexts.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P31371 (M1-S208)

Gene ID
Molecular Construction
N-term
FGF-9 (M1-S208)
Accession # P31371
6*His
C-term
Protein Length

Full Length

Synonyms
Fibroblast growth factor 9; FGF-9; GAF; HBGF-9
AA Sequence

MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Predicted Molecular Mass
22.1 kDa
Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-9 Protein, Human (His)
Cat. No.:
HY-P700071AF
Quantity:
MCE Japan Authorized Agent: