1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-8
  6. Animal-Free FGF-8b Protein, Human/Mouse (His)

Animal-Free FGF-8b Protein, Human/Mouse (His)

Cat. No.: HY-P700070AF
Handling Instructions Technical Support

Animal-Free FGF-8b Protein, Human/Mouse (His) is the recombinant human-derived animal-FreeFGF-8b protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Animal-Free FGF-8b Protein, Human/Mouse (His) is the recombinant human-derived animal-FreeFGF-8b protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Background

FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.4-3.8 ng/mL. The specific activity of recombinant human FGF-8b is >2 x 105IU/mg

Species

Mouse; Human

Source

E. coli

Tag

C-6*His

Accession

P55075-3/P37237-2 (Q33-R215)

Gene ID
Molecular Construction
N-term
FGF-8b (Q33-R215)
Accession # P55075-3/P37237-2
6*His
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B
AA Sequence

MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Predicted Molecular Mass
22.1 kDa
Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% sarkosyl in PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-8b Protein, Human/Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-8b Protein, Human/Mouse (His)
Cat. No.:
HY-P700070AF
Quantity:
MCE Japan Authorized Agent: