1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-23
  6. Animal-Free FGF-23 Protein, Human (His)

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. Animal-Free FGF-23 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-23 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. Animal-Free FGF-23 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-23 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

FGF-23 protein functions as a crucial regulator of phosphate homeostasis, as evidenced by its ability to inhibit renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in up-regulating EGR1 expression in the presence of KL and acts directly on the parathyroid to decrease PTH secretion. This protein is involved in the regulation of vitamin-D metabolism and acts as a negative regulator of osteoblast differentiation and matrix mineralization. The interaction of FGF-23 with FGFR1, FGFR2, FGFR3, and FGFR4 further underscores its significance in cellular processes. Furthermore, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, serving as crucial coreceptors in this regulatory network.

Biological Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED50 for this effect is <0.3 μg/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9GZV9 (Y25-F251)

Gene ID
Molecular Construction
N-term
FGF-23 (Y25-F251)
Accession # Q9GZV9
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
FGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor
AA Sequence

MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Weight

Approximately 26.27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-23 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-23 Protein, Human (His)
Cat. No.:
HY-P700064AF
Quantity:
MCE Japan Authorized Agent: