1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily T Cell CD Proteins NK Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Superfamily Ligands FasL/CD178 FasL/CD178
  5. FasL/CD178
  6. Animal-Free Fas Ligand Protein, Human (His)

Animal-Free Fas Ligand Protein, Human (His)

Cat. No.: HY-P700052AF
Handling Instructions Technical Support

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells. However the membrane-bound isoform could be responsible for its inflammatory activity. Animal-Free Fas Ligand Protein, Human (His) has a total length of 152 amino acids (Q130-L281), is expressed in E. coli with N-terminal His-tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Animal-Free Fas Ligand Protein, Human (His) has a total length of 152 amino acids (Q130-L281), is expressed in E. coli with N-terminal His-tag.This product is for cell culture use only.

Background

Fas Ligand (FasL; FASLG; CD95L), is a ligand for TNFRSF6/FAS belonging to the tumor necrosis factor (TNF). FasL is a type II transmembrane protein, riggering apoptosis of lymphocytes[1].
FasL is expressed on a variety of cell types, including T cells, natural killer (NK) cells, monocytes, neutrophils, breast epithelial cells, and vascular endothelial cells[2].
FasL exerts different biological activity by cleaved into 4 isoforms including membrane form, soluble form, ADAM10-processed FasL form (APL) and SPPL2A-processed FasL form (SPA). Among them, the membrane-bound form and a soluble form generated by proteolytic action of matrix metalloproteinases (MMP)[2].
FasL or soluble FasL binding to Fas results in receptor aggregation and in the interaction of a protein called Fas-associated death domain with the Fas cytoplasmic tail. The interaction triggers a cascade of intracellular events, including the activation of the IL-1-converting enzyme-like cysteine protease (caspase 8), that ultimately leads to nucleoprotein cleavage, DNA fragmentation, and cell apoptosis[5].
The loss of function due to mutations in murine FasL, murine Fas, human Fas, or human FasL leads to lymphoproliferation, lymphadenopathy, and autoimmune diseases[1][3].
Meanwhile, defective activation-induced cell death (AICD) results in spontaneous mutation of Fas and FasL genes in mice with lupus-like autoimmune disease[3].
Human Fas Ligand also involves in Jurkat cell apoptosis and binds TNFRSF6B/DcR3 to bolck apoptosis, which is a decoy receptor of apoptosis termination[2].
FasL is widely found in different animals, while the sequence in Human is different from Rat and Mouse with similarity of 77.26% and 78.06%, respectively.

In Vitro

Human soluble FasL (4 units/mL; 18 hr) induces neutrophil infiltration[4].
Human membrane-bound FasL (4 units/mL; 18 hr) is found to induce IL-1β release in plastic adherent macrophages separated from 4-day PEC instead of recombinant mouse soluble FasL (WX1)[4].
Soluble FasL (.1-1 nM) of human induces chemotaxis of mouse neutrophils in vitro at concentrations incapable of inducing cell apoptosis.[6].

In Vivo

Purified human soluble FasL (-1 ng; i.p.; single dose) does not show neutrophil chemotactic activity in vivo in ddY mice[4].
Expressing membrane-bound FasL (FFL, FDC2) but not soluble FasL (FFS) rejects tumor cells quickly than the control in wild-type mice[4].

Biological Activity

Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human FasL is >1 x 106 IU/mg

Species

Human

Source

E. coli

Tag

N-His

Accession

P48023 (Q130-L281)

Gene ID

356  [NCBI]

Molecular Construction
N-term
His
Animal-Free Fas Ligand (Q130-L281)
Accession # P48023
C-term
Protein Length

Full Length of FASLG soluble form

Synonyms
soluble Fas Ligand (sFasL); TNFSF6; CD95L; Apo I Ligand; APTL; APT1LG1; CD178
AA Sequence

QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Weight

Approximately 17.31 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Animal-Free Fas Ligand Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Fas Ligand Protein, Human (His)
Cat. No.:
HY-P700052AF
Quantity:
MCE Japan Authorized Agent: