1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. ENA-78
  6. Animal-Free ENA-78/CXCL5 Protein, Human (His)

Animal-Free ENA-78/CXCL5 Protein, Human (His)

Cat. No.: HY-P700047AF
Handling Instructions Technical Support

The CXCL5 protein is critical in neutrophil activation and displays enhanced chemotactic activity on neutrophils, with increased potency of ENA-78(8-78) and ENA-78(9-78) isoforms three times. Structurally, CXCL5 exists as monomers and homodimers, emphasizing its multifunctional molecular configuration. Animal-Free ENA-78/CXCL5 Protein, Human (His) is the recombinant human-derived animal-FreeENA-78/CXCL5 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CXCL5 protein is critical in neutrophil activation and displays enhanced chemotactic activity on neutrophils, with increased potency of ENA-78(8-78) and ENA-78(9-78) isoforms three times. Structurally, CXCL5 exists as monomers and homodimers, emphasizing its multifunctional molecular configuration. Animal-Free ENA-78/CXCL5 Protein, Human (His) is the recombinant human-derived animal-FreeENA-78/CXCL5 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The CXCL5 protein plays a pivotal role in neutrophil activation, exhibiting heightened chemotactic activity for neutrophil granulocytes in vitro, particularly with its ENA-78(8-78) and ENA-78(9-78) isoforms displaying a threefold increase in chemotactic potency. Structurally, CXCL5 exists both as a monomer and a homodimer, emphasizing its versatility in molecular configurations. This dual nature suggests its capacity to engage in distinct interactions and functional activities related to neutrophil activation, highlighting CXCL5's crucial role in immune response modulation.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P42830 (R45-N114)

Gene ID
Molecular Construction
N-term
6*His
CXCL5 (R45-N114)
Accession # P42830
C-term
Protein Length

Partial

Synonyms
ENA-78/CXCL5; ENA78; SCYB5
AA Sequence

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Predicted Molecular Mass
8.5 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free ENA-78/CXCL5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free ENA-78/CXCL5 Protein, Human (His)
Cat. No.:
HY-P700047AF
Quantity:
MCE Japan Authorized Agent: