1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. EGF Superfamily
  4. EGF
  5. Animal-Free EGF Protein, Pig (His)

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free EGF Protein, Pig (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

EGF Protein serves as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro settings, and it exhibits growth-promoting effects on certain fibroblasts in cell culture. In addition to its role in tissue growth, this protein functions as a magnesiotropic hormone, actively promoting magnesium reabsorption in the renal distal convoluted tubule by engaging EGFR and activating the magnesium channel TRPM6, as suggested by similarity. Furthermore, EGF Protein engages in molecular interactions such as binding to EGFR, facilitating EGFR dimerization, and interacting with RHBDF1. The latter interaction may contribute to the potential retention of EGF in the endoplasmic reticulum, regulating its degradation through endoplasmic reticulum-associated degradation (ERAD). Additionally, its interaction with RHBDF2 hints at a multifaceted role in cellular processes, further highlighting the versatility of EGF Protein in various molecular pathways.

Species

Pig

Source

E. coli

Tag

C-6*His

Accession

Q00968 (N970-R1022)

Gene ID
Molecular Construction
N-term
EGF (N970-R1022)
Accession # Q00968
6*His
C-term
Protein Length

Partial

Synonyms
Pro-epidermal growth factor; Urogastrone; EGF; HOMG4
AA Sequence

MNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR

Predicted Molecular Mass
7.1 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free EGF Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free EGF Protein, Pig (His)
Cat. No.:
HY-P700236AF
Quantity:
MCE Japan Authorized Agent: