1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. BCA-1/CXCL13
  6. Animal-Free BCA-1/CXCL13 Protein, Human (His)

Animal-Free BCA-1/CXCL13 Protein, Human (His)

Cat. No.: HY-P700044AF
Handling Instructions Technical Support

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. Animal-Free BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived animal-FreeBCA-1/CXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. Animal-Free BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived animal-FreeBCA-1/CXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The BCA-1/CXCL13 protein acts as a selective chemotactic factor for B-lymphocytes, distinguishing its effects from T-lymphocytes, monocytes, and neutrophils. Unlike other chemokines, it does not induce calcium release in B-lymphocytes. Its specificity for B-lymphocytes is evidenced by its binding to BLR1/CXCR5, emphasizing its role in orchestrating B-cell migration. This selectivity in chemotactic function and receptor binding positions BCA-1/CXCL13 as a key regulator in the immune system, contributing to the precise recruitment and activation of B-lymphocytes within the cellular microenvironment.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED50 for this effect is <20 ng/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O43927 (V23-R94)

Gene ID
Molecular Construction
N-term
6*His
CXL13 (V23-R94)
Accession # O43927
C-term
Protein Length

Partial

Synonyms
BCA-1/CXCL13; C-X-C motif chemokine 13; BCA1; BLC; SCYB13
AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR

Predicted Molecular Mass
9.5 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free BCA-1/CXCL13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BCA-1/CXCL13 Protein, Human (His)
Cat. No.:
HY-P700044AF
Quantity:
MCE Japan Authorized Agent: