1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. APRIL Proteins
  6. Animal-Free APRIL/TNFSF13 Protein, Human (His)

Animal-Free APRIL/TNFSF13 Protein, Human (His)

Cat. No.: HY-P700016AF
Handling Instructions Technical Support

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. Animal-Free APRIL/TNFSF13 Protein, Human (His) is produced by E. coli (A105-L250) with C-terminal His-tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. Animal-Free APRIL/TNFSF13 Protein, Human (His) is produced by E. coli (A105-L250) with C-terminal His-tag.This product is for cell culture use only.

Background

APRIL/TNFSF13 Protein is a cytokine and an independent secretory ligand belongs to TNF family. It binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. APRIL/TNFSF13 Protein plays a role in the regulation of tumor cell growth, may involve in monocyte/macrophage-mediated immunological processes[1].
APRIL is produced by myeloid cells and their precursors in the bone marrow. APRIL is retained by surrounding tissues and via HSPG (heparan sulfate proteoglycans) is not retained. It accumulates in large amounts in the bone marrow, leading to more rapid cell maturation and peripheral burst. As for infection response, tonsil mucosa neutrophils present within the infected tissue were the main source of APRIL, whereas keratinocytes were the primary source of APRIL in tissues showing no symptoms of infection[2].
APRIL acts function by binding BCMA (B cell maturation antigen) and TACI (transmembrane activator and CAML-interactor) and competes with TALL-I (also called BLyS or BAFF) for receptor binding. Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B cells, and soluble BCMA is a dominant-negative molecule capable of inhibiting antibody production in vivo. Thus, APRIL stimulates in vitro the proliferation of primary lymphocytes, in addition to lymphoma cell lines, and promotes in vivo the accumulation of B cells in the spleen. Therefore, APRIL-TALL-I and BCMA-TACI form a two ligands-two receptors pathway involved in stimulation of B and T cell function. Moreover, APRIL is also a stimulator of tumor cell growth although TNRF death ligand-1 (TRDL-1), which induces tumor cell apoptosis[1].
It is a type II membrane protein with a cytoplasmic domain, a hydrophobic transmembrane region, and an extracellular domain[2]. Mouse and human APRIL proteins are 82% identical in the COOH-terminal part of the extracellular domain, which contains the presumed receptor-binding domain. And the protein sequences of human and mouse are different with similarity of 80.91%. The APRIL protein is most often studied in the context of lymphoid malignancies[1].

In Vitro

APRIL (human; 1 ng/mL; 48 h; 37 ℃) prominently restores colorectal cancer (CRC) cell migration and invasion while APRIL knockdown suppresses migration and invasion[3].
APRIL (human; 25 or 1 ng/mL; 72 h; 37 ℃) results in an increase in proliferation rate of normal adult astrocytes and in four of eight cell lines tested[4].

In Vivo

APRIL-transfected NIH-3T3 cells (15 cells; s.c.; single dose) show an increased rate of tumor growth in nude mice compared with the parental cell line, and induces tumors after only 3-4 weeks[5].

Biological Activity

Measured by its ability to induce cell death in Jurkat cells. The ED50 for this effect is 2.6-4.0 μg/mL

Species

Human

Source

E. coli

Tag

C-His

Accession

O75888 (A105-L250)

Gene ID
Molecular Construction
N-term
AITRL (A105-L250)
Accession # O75888
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TNFSF13; CD256; TALL-2; TALL2; TNLG7B; TRDL-1; UNQ383/PRO715; ZTNF2
AA Sequence

MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Molecular Weight

Approximately 17.29 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Animal-Free APRIL/TNFSF13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free APRIL/TNFSF13 Protein, Human (His)
Cat. No.:
HY-P700016AF
Quantity:
MCE Japan Authorized Agent: