1. Recombinant Proteins
  2. Receptor Proteins Animal-free Recombinant Proteins
  3. Animal-Free AGER Protein, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

AGER Protein, a cell surface pattern recognition receptor, adeptly senses endogenous stress signals with a wide-ranging ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Accumulation of advanced glycosylation end products, especially prevalent in aging and diabetes, triggers inflammatory responses at various disease sites, including diabetes, vascular complications, neurodegenerative disorders, and cancers. RAGE, upon ligand binding, utilizes TIRAP and MYD88 as adapters to transduce signals, ultimately inducing inflammatory cytokines IL6, IL8, and TNFalpha through NF-kappa-B activation. Noteworthy interactions include S100A12-triggered cellular activation, S100B-induced apoptosis post-myocardial infarction, and the facilitation of amyloid-beta peptide translocation in cortical neurons. AGER also plays a role in endothelial albumin transcytosis with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability, and mediates the loading of HMGB1 in extracellular vesicles for hepatocyte pyroptosis via the NLRP3 inflammasome. Additionally, it promotes extracellular hypomethylated DNA uptake for the activation of inflammatory responses. The constitutive homodimeric and oligomeric forms, along with interactions with S100 proteins, APP, TIRAP, and HMGB1, highlight the intricate involvement of AGER Protein in various cellular processes and pathological conditions.

Biological Activity

Immobilized Recombinant Human HMGB1 at 5 μg/mL (100 μL/well) can bind Recombinant Human AGER. The ED50 for this effect is 7.832 nM.

  • Immobilized Recombinant Human HMGB1 at 5 μg/mL (100 μL/well) can bind Recombinant Human AGER. The ED50 for this effect is 7.832 nM .
Species

Human

Source

E. coli

Tag

C-His

Accession

Q15109 (A23-S300)

Gene ID

177  [NCBI]

Molecular Construction
N-term
AGER (A23-S300)
Accession # Q15109
His
C-term
Protein Length

Partial

Synonyms
Advanced glycosylation end product-specific receptor; Ager; RAGE
AA Sequence

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Weight

Approximately 30.94 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free AGER Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free AGER Protein, Human (His)
Cat. No.:
HY-P700146AF
Quantity:
MCE Japan Authorized Agent: