1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. TNF Superfamily Ligands 4-1BBL
  5. 4-1BBL
  6. Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His)

Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His)

Cat. No.: HY-P700160AF
Handling Instructions Technical Support

4-1BBL/TNFSF9 Protein, a cytokine, binds TNFRSF9, inducing proliferation in activated peripheral blood T-cells.It's implicated in activation-induced cell death (AICD) and contributes to cognate interactions between T-cells and B-cells/macrophages.Functioning as a homotrimer enhances its biological activity.Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) is the recombinant mouse-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BBL/TNFSF9 Protein, a cytokine, binds TNFRSF9, inducing proliferation in activated peripheral blood T-cells.It's implicated in activation-induced cell death (AICD) and contributes to cognate interactions between T-cells and B-cells/macrophages.Functioning as a homotrimer enhances its biological activity.Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) is the recombinant mouse-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

The 4-1BBL/TNFSF9 protein is a cytokine that specifically binds to TNFRSF9, triggering the proliferation of activated peripheral blood T-cells. It is believed to be involved in activation-induced cell death (AICD) and may also contribute to the cognate interactions between T-cells and B-cells/macrophages. This protein functions as a homotrimer, further enhancing its biological activity.

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Biological Activity

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <0.05 μg/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P41274 (R104-T211)

Gene ID
Molecular Construction
N-term
4-1BBL (R104-T211)
Accession # P41274
His
C-term
Protein Length

Partial

Synonyms
41BB Ligand; 4-1BB Ligand; 4-1BBL; CD137L; TNFSF9
AA Sequence

MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFT

Molecular Weight

Approximately 23.91 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His)
Cat. No.:
HY-P700160AF
Quantity:
MCE Japan Authorized Agent: