1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 4
  5. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)

ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)

Cat. No.: HY-P700562
Handling Instructions Technical Support

ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli , with N-GST labeled tag.

Background

The ANGPTL4/Angiopoietin-related 4 protein functions as a mediator in the inactivation of lipoprotein lipase (LPL), playing a crucial role in the regulation of triglyceride clearance from the blood serum and lipid metabolism. Additionally, it is implicated in the potential regulation of glucose homeostasis and insulin sensitivity. ANGPTL4 inhibits endothelial cell proliferation, migration, and tubule formation, thereby reducing vascular leakage. It also interferes with the adhesion of endothelial cells to the extracellular matrix, inhibiting the reorganization of the actin cytoskeleton, formation of actin stress fibers, and focal adhesions. In certain contexts, ANGPTL4 may modulate angiogenesis related to tumor development. The cleaved form of ANGPTL4 exhibits higher activity in LPL inactivation compared to the uncleaved protein, highlighting its multifaceted role in metabolic and vascular regulation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9BY76-1 (V28-E403)

Gene ID
Molecular Construction
N-term
GST
ANGPTL4 (V28-E403)
Accession # Q9BY76-1
C-term
Protein Length

Partial

Synonyms
Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein ; HFARP
AA Sequence

VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

Predicted Molecular Mass
69.6 kDa
Molecular Weight

Approximately 66 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)
Cat. No.:
HY-P700562
Quantity:
MCE Japan Authorized Agent: