1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin-4
  5. Angiopoietin-4 Protein, Human (HEK293, Fc)

Angiopoietin 4 protein (ANGPT4) critically binds to TEK/TIE2, regulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation. In addition to regulation, ANGPT4 promotes endothelial cell survival, migration, and angiogenesis. Angiopoietin-4 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-4 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Angiopoietin 4 protein (ANGPT4) critically binds to TEK/TIE2, regulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation. In addition to regulation, ANGPT4 promotes endothelial cell survival, migration, and angiogenesis. Angiopoietin-4 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-4 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The Angiopoietin-4 (ANGPT4) protein exhibits a pivotal role as it binds to TEK/TIE2, thereby modulating ANGPT1 signaling. Beyond its regulatory function, ANGPT4 has the capability to induce tyrosine phosphorylation of TEK/TIE2. Notably, it plays a crucial role in promoting endothelial cell survival, migration, and angiogenesis. Structurally, ANGPT4 exists as a homodimer, connected by disulfide linkages, highlighting its oligomeric nature. Its functional interactions with TEK/TIE2 further emphasize its integral role in orchestrating cellular processes essential for angiogenesis and vascular homeostasis.

In Vitro

Angiopoietin-4 acts as an angiogenic inhibitor, and it (50 ng/mL; 8 h, 24 h) reduces endothelial migration and tube formation in co-cultured HUVECs with transfected fibroblasts[1].

Biological Activity

Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).

  • Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).
Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9Y264-1 (M282-I503)

Gene ID
Molecular Construction
N-term
hFc
Angiopoietin-4 (M282-I503)
Accession # Q9Y264-1
C-term
Protein Length

Partial

Synonyms
Angiopoietin-4; AGP4; ANG-3; ANG-4; ANGPT4
AA Sequence

MAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI

Molecular Weight

Approximately 58-77 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Angiopoietin-4 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-4 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74411
Quantity:
MCE Japan Authorized Agent: