1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-2
  5. Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc)

Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc)

Cat. No.: HY-P70123
Handling Instructions Technical Support

ANGPT2 is a secreted factor on the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway and is involved in tumor angiogenesis. In the presence of ANGPT1, ANGPT2 antagonizes ANGPT1-mediated Tie2 phosphorylation, leading to vessel sprouting or degeneration depending on the level of VEGF-A. Overexpression or inhibition of ANGPT2 increases or decreases angiogenic capacity, respectively. Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPT2 is a secreted factor on the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway and is involved in tumor angiogenesis. In the presence of ANGPT1, ANGPT2 antagonizes ANGPT1-mediated Tie2 phosphorylation, leading to vessel sprouting or degeneration depending on the level of VEGF-A. Overexpression or inhibition of ANGPT2 increases or decreases angiogenic capacity, respectively. Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

ANGPT2 is a secreted factor on the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway and has been implicated in diseases related to blood vessel growth. Drivers of angiogenesis include VEGFR, angiopoietin (ANG) junctions, placental growth factor (PlGF), and transforming growth factor beta in vascular endothelial cells. Tie2 (TEK) is a coreceptor for ANGPT1 and ANGPT2. ANGPT1 activates Tie2, and ANGPT2 acts as an upstream- and downstream-dependent agonist/antagonist of Tie2. In the presence of ANGPT1, ANGPT2 antagonizes ANGPT1-mediated Tie2 phosphorylation, leading to vessel sprouting or degeneration depending on the level of VEGF-A. In hypoxic environments and cancer, ANGPT2 is produced from mesenchymal stem cells and tumor cells. ANGPT2 primarily induces angiogenesis in tumors, and ANGPT2 expression is consistent with microvessel density, tumor size, and metastatic efficacy. Overexpression or inhibition increases or decreases angiogenic capacity, respectively. ANGPT2 inhibition restored vascular stability and suppressed tumor angiogenesis. ANGPT2 also promotes tumor cell growth in an autocrine and paracrine manner. Stimulation of TIE2 in tumor cells by ANGPT2 activates downstream cell proliferation signaling, and the ANGPT2/TIE2 axis may provide a therapeutic target for aggressive non-functioning (NF) pituitary neuroendocrine tumors (PitNET), a type of unresectable tumor. It has been reported that MYBL1 can directly target the ANGPT2 promoter to enhance ANGPT2 expression and transcriptionally upregulate ANGPT2 mRNA expression by interacting with PRMT5, MEP50, and WDR5. ANGPT2 is also a prognostic factor in metastatic colorectal cancer (CRC).

Biological Activity

Immobilized Rhesus TIE2 His at 2 μg/ml (100 μl/well) can bind Rhesus Macaque Angiopoietin-2. The ED50 for this effect is 173.6 ng/mL.

  • Immobilized Rhesus TIE2 His at 2 μg/mL (100 μL/well) can bind Rhesus Macaque Angiopoietin-2. The ED50 for this effect is 173.6 ng/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

XM_001097949 (Y19-F495)

Gene ID
Molecular Construction
N-term
Angiopoietin-2 (Y19-F495)
Accession # XM_001097949
hFc
C-term
Protein Length

Partial

Synonyms
rRhANG2, Fc; AGPT2; ANG2; ANG-2; angiopoietin 2; Angiopoietin-2; angiopoietin-2a; angiopoietin-2B; angiopoitin 2; ANGPT2; Tie2-ligand
AA Sequence

YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Molecular Weight

90-120 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc)
Cat. No.:
HY-P70123
Quantity:
MCE Japan Authorized Agent: