1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-2
  5. Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Cat. No.: HY-P7510
Handling Instructions Technical Support

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) is a circulating antagonistic ligand of the endothelial-specific Tie2 receptor and has been identified as an important gatekeeper of endothelial activation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) is a circulating antagonistic ligand of the endothelial-specific Tie2 receptor and has been identified as an important gatekeeper of endothelial activation.

Background

Angiopoietins are peptides involved in embryonic vascular development. Of the four angiopoietins that have been identified, angiopoietin 1 and angiopoietin 2 (ANGPT1 and ANGPT2, respectively) are the best described. Angiopoietin 2, produced by endothelial cells, also binds to the Tie2 receptor and acts as an antagonistic factor without activating the receptor.

Biological Activity

1. Measured by its binding ability in a functional ELISA. Immobilized Human Angiopoietin-2 at 1 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED50 for this effect is 11.71 ng/mL.
2. Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind Angiopoietin-2 Protein, Human (222a.a, HEK293, His) with an affinity constant of 2.091E-09 M as determined in BLI assay.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Angiopoietin-2 at 1 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED50 for this effect is 11.71 ng/mL.
  • Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind Angiopoietin-2 Protein, Human (222a.a, HEK293, His) with an affinity constant of 2.091E-09 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O15123-1 (K275-F496)

Gene ID

285  [NCBI]

Molecular Construction
N-term
Angiopoietin-2 (K275-F496)
Accession # O15123-1
6*His
C-term
Protein Length

Partial

Synonyms
rHuAngiopoietin-2, His; ANGPT2; ANG2; Angiopoietin-2
AA Sequence

KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Weight

30-35 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM MOPS, 150 mM NaCl, 10% CHAPS, pH 7.5 or 20 mM PB, 150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Human (222a.a, HEK293, His)
Cat. No.:
HY-P7510
Quantity:
MCE Japan Authorized Agent: