1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar)

Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar)

Cat. No.: HY-P71826
Handling Instructions Technical Support

The angiopoietin-4 protein has specific bactericidal activity against Enterococcus faecalis and Listeria monocytogenes, distinct from its lack of efficacy against Lactobacillus innocua and Escherichia coli. Furthermore, Angiogenin-4 exerts pro-angiogenic effects in vitro, suggesting its involvement in supporting the formation of new blood vessels. Angiogenin-4 Protein, Mouse (P.pastoris) is the recombinant mouse-derived Angiogenin-4 protein, expressed by P. pastoris , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The angiopoietin-4 protein has specific bactericidal activity against Enterococcus faecalis and Listeria monocytogenes, distinct from its lack of efficacy against Lactobacillus innocua and Escherichia coli. Furthermore, Angiogenin-4 exerts pro-angiogenic effects in vitro, suggesting its involvement in supporting the formation of new blood vessels. Angiogenin-4 Protein, Mouse (P.pastoris) is the recombinant mouse-derived Angiogenin-4 protein, expressed by P. pastoris , with N-6*His, N-SUMO labeled tag.

Background

Angiogenin-4 (ANG4), .exhibits notable bactericidal activity against E. faecalis and L. monocytogenes, distinguishing its antimicrobial effects. However, it does not demonstrate bactericidal activity against L. innocua and E. coli. Besides its antimicrobial role, ANG4 also plays a role in promoting angiogenesis in vitro, showcasing its involvement in the formation of new blood vessels. Despite having low ribonuclease activity in vitro, ANG4 stands out in its ability to stimulate the proliferation of melanoma cells, while showing no such effect on endothelial cells or fibroblasts in vitro. These multifaceted functions of ANG4 highlight its diverse roles in host defense, angiogenesis, and cell proliferation, suggesting potential implications for therapeutic strategies targeting infections and cancer. Further research is essential to unravel the specific molecular mechanisms underlying these activities.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

P. pastoris

Tag

N-6*His;N-SUMOstar

Accession

Q3TMQ6 (Q25-P144)

Gene ID

219033  [NCBI]

Molecular Construction
N-term
6*His-SUMOstar
Angiogenin-4 (Q25-P144)
Accession # Q3TMQ6
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ang4Angiogenin-4; EC 3.1.27.-
AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Molecular Weight

Approximately 33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar)
Cat. No.:
HY-P71826
Quantity:
MCE Japan Authorized Agent: