1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Aminoacylase-1 Protein, Mouse (HEK293, His)

The Aminoacylase-1 protein plays an important role in cellular processes as it catalyzes the hydrolysis of N-acetylated amino acids, promoting the conversion of these compounds into acetate and free amino acids. This enzymatic activity highlights the importance of Aminoacylase-1 in the metabolic pathways responsible for the breakdown of N-acetylated amino acids, helping to release essential amino acids and acetate as by-products. Aminoacylase-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Aminoacylase-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Aminoacylase-1 protein plays an important role in cellular processes as it catalyzes the hydrolysis of N-acetylated amino acids, promoting the conversion of these compounds into acetate and free amino acids. This enzymatic activity highlights the importance of Aminoacylase-1 in the metabolic pathways responsible for the breakdown of N-acetylated amino acids, helping to release essential amino acids and acetate as by-products. Aminoacylase-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Aminoacylase-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Aminoacylase-1 is an enzyme that catalyzes the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. This enzymatic activity is part of the process of amino acid metabolism, where N-acetylated amino acids are cleaved to release the corresponding amino acids and acetate. Aminoacylase-1's role in this hydrolytic reaction contributes to the regulation of amino acid levels and is essential for maintaining cellular homeostasis. This enzyme plays a key part in the intricate network of metabolic pathways governing amino acid utilization and is involved in processes such as protein synthesis and energy production.

Biological Activity

Measured by its ability to cleave N-acetyl-L-Methione (Ac-Met). The specific activity is 19928.580 pmol/min/µg.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q99JW2 (M1-S408)

Gene ID
Molecular Construction
N-term
Aminoacylase-1 (M1-S408)
Accession # Q99JW2
His
C-term
Protein Length

Partial

Synonyms
Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; Acy1
AA Sequence

MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALAS

Molecular Weight

Approximately 55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Aminoacylase-1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aminoacylase-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75514
Quantity:
MCE Japan Authorized Agent: