1. Recombinant Proteins
  2. Receptor Proteins
  3. Receptor Serine/Threonine Kinases
  4. Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
  5. AMHR2/MISRII Protein, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Background

Upon binding its ligand, AMHR2/MISRII Protein orchestrates the assembly of a receptor complex comprising two type II and two type I transmembrane serine/threonine kinases. The type II receptors initiate the signaling cascade by phosphorylating and activating the type I receptors, which, in turn, undergo autophosphorylation. Subsequently, these activated type I receptors engage with and activate SMAD transcriptional regulators, culminating in the modulation of downstream gene expression. Notably, AMHR2/MISRII serves as the receptor for anti-Muellerian hormone, playing a pivotal role in mediating the cellular responses triggered by this hormone.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human rhMIS at 3 μg/mL (100μL/well) can bind Biotinylated Mouse AMHR2. The ED50 for this effect is 240.7 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human rhMIS at 3 μg/mL (100μL/well) can bind Biotinylated Mouse AMHR2 .The ED50 for this effect is 240.7 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8K592 (Q16-M147)

Gene ID
Molecular Construction
N-term
AMHR2 (Q16-M147)
Accession # Q8K592
His
C-term
Protein Length

Extracellular Domain

Synonyms
MIS RII; MRII; AMHR2; AMHR; MISR2; AMH type II receptor
AA Sequence

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Weight

approximately 25 kDa & 30 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AMHR2/MISRII Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMHR2/MISRII Protein, Mouse (HEK293, His)
Cat. No.:
HY-P78693
Quantity:
MCE Japan Authorized Agent: