1. Recombinant Proteins
  2. Others
  3. Amelotin Protein, Human (HEK293, Fc)

Amelotin Protein is a key promoter of calcium phosphate mineralization, crucial in amelogenesis maturation. It plays a vital role in forming the compact and mineralized aprismatic enamel surface layer, emphasizing its crucial involvement in orchestrating molecular events for robust enamel structure during tooth maturation. Amelotin Protein, Human (HEK293, Fc) is the recombinant human-derived Amelotin, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Amelotin Protein is a key promoter of calcium phosphate mineralization, crucial in amelogenesis maturation. It plays a vital role in forming the compact and mineralized aprismatic enamel surface layer, emphasizing its crucial involvement in orchestrating molecular events for robust enamel structure during tooth maturation. Amelotin Protein, Human (HEK293, Fc) is the recombinant human-derived Amelotin, expressed by HEK293 , with C-mFc labeled tag.

Background

Amelotin emerges as a key promoter of calcium phosphate mineralization, playing a pivotal role in the intricate process of amelogenesis during the maturation stage. Specifically, Amelotin's contribution is vital in the formation of the compact and mineralized aprismatic enamel surface layer. This underscores its crucial involvement in orchestrating the intricate molecular events that lead to the development of a robust and mineralized enamel structure during tooth maturation.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q6UX39-1 (L17-Q209)

Gene ID
Molecular Construction
N-term
Amelotin (M1-Q209)
Accession # Q6UX39
mFc
C-term
Synonyms
Amelotin; AMTN
AA Sequence

LPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Amelotin Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amelotin Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76725
Quantity:
MCE Japan Authorized Agent: