1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Phosphatase
  4. Alkaline Phosphatase
  5. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)

Cat. No.: HY-P72822
Handling Instructions Technical Support

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.

Background

ALPI protein serves as an alkaline phosphatase with the capacity to hydrolyze various phosphate compounds.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is >10000 pmol/min/µg.

  • Measured by its ability to cleave the fluorogenic peptide substrate, 4-Methylumbelliferyl phosphat. The specific activity is 158755.391 pmol/min/µg, as measured under the described conditions.
Assay Procedure

Materials
Assay buffer: 50 mM Tris, 1 mM MgCl2, pH 9.0
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) (HY-P72822)
Substrate: 4-Methylumbelliferyl phosphate, dissolved in deionized water to 10 mM
Standard: 4-Methumbelliferone

Procedure
1. Standard Curve: Dilute 4-Methylumbelliferone in assay buffer to concentrations of 0, 6.25, 12.5, 25, 50, 100 μmol/L. Add 100 μL of each concentration to the wells of a black microplate. Read the fluorescence with excitation and emission wavelengths of 365 nm and 445 nm (top read). Plot the measured RFU on the y-axis and the concentration of the standard (μmol/L) on the x-axis to create the standard curve and obtain the standard curve equation.
2. Dilute Human ALPI to 0.1 μg/mL in assay buffer.
3. Dilute the substrate to 50 μM in assay buffer.
4. Experimental group: Add 50 μL of 0.1 μg/mL ALPI to the wells and initiate the reaction by adding 50 μL of 50 μM substrate.
Control group: Add 50 μL of assay buffer and 50 μL of 50 μM substrate.
5. Read the fluorescence in kinetic mode for 5 minutes with excitation and emission wavelengths of 365 nm and 445 nm, respectively.
6. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Human ALPI: 0.005 μg
Substrate: 25 μM

Species

Human

Source

HEK293

Tag

C-His

Accession

P09923 (V20-D503)

Gene ID

248  [NCBI]

Molecular Construction
N-term
ALPI (V20-D503)
Accession # P09923
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Intestinal-type alkaline phosphatase; IAP; ALPI; Alkaline Phosphatase
AA Sequence

VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Molecular Weight

Approximately 70-80 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His)
Cat. No.:
HY-P72822
Quantity:
MCE Japan Authorized Agent: