1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Alpha-hemolysin Protein, S. aureus (P.pastoris, His)

Alpha-hemolysin Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71825
Handling Instructions Technical Support

Alpha-hemolysin, S. aureus, is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can disrupt corneal epithelial cell barrier function, inhibit epithelial cell migration and motility, and promote infection by enhancing the bacterial invasion of host cells. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is a recombinant Alpha-hemolysin protein expressed by P. pastoris yeast with N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Alpha-hemolysin, S. aureus, is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can disrupt corneal epithelial cell barrier function, inhibit epithelial cell migration and motility, and promote infection by enhancing the bacterial invasion of host cells. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is a recombinant Alpha-hemolysin protein expressed by P. pastoris yeast with N-6*His tag.

Background

Alpha-hemolysin, S. aureus is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can aggregate into heptamer transmembrane pores on the target cell membrane, leading to cell lysis. Alpha-hemolysin promotes infection mainly by destroying the barrier function of corneal epithelial cells, inhibiting epithelial cell migration and viability, and enhancing the invasive ability of bacteria to host cells. The perforation mechanism of alpha-hemolysin is related to ion imbalance and signaling pathway disorder caused by membrane perforation. Alpha-hemolysin can be used to study the pathological mechanism of infectious keratitis, especially its role in delayed corneal wound healing. Blocking alpha-hemolysin or limiting staphylococcal colonization has become a potential inhibitory strategy for corneal trauma and infectious diseases.

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-6*His

Accession

Q2G1X0 (A27-N319)

Gene ID

3920722  [NCBI]

Molecular Construction
N-term
6*His
Alpha-hemolysin (A27-N319)
Accession # Q2G1X0
C-term
Protein Length

Full Length of Mature Protein

Synonyms
hly; hla; Alpha-HL; Alpha-toxin
AA Sequence

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35-60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Alpha-hemolysin Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alpha-hemolysin Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71825
Quantity:
MCE Japan Authorized Agent: