Alpha-hemolysin Protein, S. aureus (P.pastoris, His)

Alpha-hemolysin, S. aureus, is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can disrupt corneal epithelial cell barrier function, inhibit epithelial cell migration and motility, and promote infection by enhancing the bacterial invasion of host cells. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is a recombinant Alpha-hemolysin protein expressed by P. pastoris yeast with N-6*His tag.

Alpha-hemolysin, S. aureus is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can aggregate into heptamer transmembrane pores on the target cell membrane, leading to cell lysis. Alpha-hemolysin promotes infection mainly by destroying the barrier function of corneal epithelial cells, inhibiting epithelial cell migration and viability, and enhancing the invasive ability of bacteria to host cells. The perforation mechanism of alpha-hemolysin is related to ion imbalance and signaling pathway disorder caused by membrane perforation. Alpha-hemolysin can be used to study the pathological mechanism of infectious keratitis, especially its role in delayed corneal wound healing. Blocking alpha-hemolysin or limiting staphylococcal colonization has become a potential inhibitory strategy for corneal trauma and infectious diseases.

Staphylococcus aureus

P. pastoris

N-6*His

Q2G1X0 (A27-N319)

3920722  [NCBI]

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Approximately 35 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Putra I, et al. Staphylococcus aureus alpha-hemolysin impairs corneal epithelial wound healing and promotes intracellular bacterial invasion. Exp Eye Res. 2019 Apr;181:263-270.  [Content Brief]