1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-7
  6. ALK-7 Protein, Mouse (HEK293, His)

ALK-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ALK-7 protein, expressed by HEK293, with C-8*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ALK-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ALK-7 protein, expressed by HEK293, with C-8*His tag.

Background

ALK-7 is a serine/threonine protein kinase that forms a receptor complex upon ligand binding. The receptor complex consists of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate and bind to activate SMAD transcriptional regulators SMAD2 and SMAD3. ALK-7 serves as a receptor for activin AB, activin B, activin E, and NODAL. Upon binding to NODAL, ALK-7 activation leads to increased apoptosis and reduced proliferation by suppressing AKT signaling and activating the Smad2-dependent signaling pathway in pancreatic beta-cells, trophoblasts, epithelial cells, or neuronal cells. Additionally, ALK-7 acts as a positive regulator for macrophage activation, partially by downregulating PPARG expression.

Biological Activity

Immobilized Mouse ALK-7, His Tag at 0.5 μg/mL(100 μL/well) on the plate. Dose response curve for Anti-ALK7 Antibody, hFc Tag with the EC50 of 3.7 ng/mL determined by ELISA.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

Q8K348 (L26-E113)

Gene ID

269275

Molecular Construction
N-term
ALK-7 (L26-E113)
Accession # Q8K348
8*His
C-term
Protein Length

Partial

Synonyms
Activin receptor type IC; ACTR-IC; ACVRLK7; ALK7
AA Sequence

LKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPRLGPTE

Predicted Molecular Mass
11.1 kDa
Molecular Weight

Approximately 20-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

Greater than 95% as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl (pH 7.5), 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALK-7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P704137
Quantity:
MCE Japan Authorized Agent: