1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. AKR1C2 Protein, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

AKR1C2 Protein is a cytosolic aldo-keto reductase that plays a pivotal role in catalyzing the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. This enzyme exhibits a likely reductase function in vivo, as evidenced by the inhibition of its oxidase activity in vitro by physiological concentrations of NADPH. AKR1C2 displays a broad positional specificity, acting on positions 3, 17, and 20 of steroids, thereby regulating the metabolism of hormones such as estrogens and androgens. Collaborating with 5-alpha/5-beta-steroid reductases, it contributes to the conversion of steroid hormones into 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Furthermore, AKR1C2 catalyzes the inactivation of the potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Specifically, it is capable of producing 17beta-hydroxy-5alpha-androstan-3-one/5alphaDHT and may also reduce conjugated steroids, such as 5alpha-dihydrotestosterone sulfate. Additionally, the protein exhibits an affinity for bile acids, further emphasizing its involvement in diverse metabolic pathways.

Biological Activity

Measured by its ability to oxidize S-1-indanol in the presence of NADP+ that incubate at roomtemperature in kinetic mode for 5 minutes. The specific activity is 54.55 pmol/min/µg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P52895 (M1-Y323)

Gene ID
Molecular Construction
N-term
6*His
AKR1C2 (M1-Y323)
Accession # P52895
C-term
Protein Length

Full Length

Synonyms
AKR-1C2; Aldo-keto reductase family 1 member C2; DD-2; AKR1C2
AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AKR1C2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AKR1C2 Protein, Human (His)
Cat. No.:
HY-P75520
Quantity:
MCE Japan Authorized Agent: