1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Ligases (EC 6)
  4. AIMP2 Protein, Human (His)

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

Background

Aminoacyl-tRNA synthetase complex interacting multifunctional protein-2 (AIMP2), which has been reported to cause selective and age-dependent degeneration of dopaminergic neurons, plays an essential role in the initiation of aSyn fibrillization and LB formation. AIMP2 first self-assembles to form amyloid-like aggregates, which interact with monomeric aSyn and induce its fibrillization in vitro as well as the formation of aSyn fibrils and LB-like inclusions in various well-established cellular and animal models of synucleinopathies. AIMP2 is part of the multiaminoacyl-tRNA synthetase complex, where it acts as a scaffold subunit to stabilize the whole complex. This complex plays a pivotal role in protein biosynthesis by catalyzing the esterification of amino acids with their corresponding tRNA. In this regard, its function suggests that it possess multiple protein-protein interaction surfaces[1].

Species

Human

Source

E. coli

Tag

N-His

Accession

Q13155 (M1-K320)

Gene ID
Molecular Construction
N-term
His
AIMP2 (M1-K320)
Accession # Q13155
C-term
Protein Length

Full Length

Synonyms
Aimp2; AIMP2_HUMAN; Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 ; ARS interacting multi functional protein 2 ; JTV 1; JTV 1 protein; JTV1; JTV1 gene; Multisynthase complex auxiliary component p38; Multisynthetase complex auxiliary component p38; P38; PRO0992; Protein JTV 1; Protein JTV-1; tRNA SYNTHETASE COFACTOR p38
AA Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Predicted Molecular Mass
39.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

AIMP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AIMP2 Protein, Human (His)
Cat. No.:
HY-P71538
Quantity:
MCE Japan Authorized Agent: