1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. AGRP Protein, Mouse (50a.a, HEK293, Fc)

The AGRP protein, encoded by the AGRP gene, regulates feeding behavior and body weight. It acts as a melanocortin receptor signaling antagonist, influencing appetite and metabolic balance. AGRP has multiple splice variants, adding to its regulatory complexity. Its expression extends beyond the central nervous system, with presence in tissues like the testis and placenta, indicating systemic involvement in physiological processes. AGRP Protein, Mouse (50a.a, HEK293, Fc) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AGRP protein, encoded by the AGRP gene, regulates feeding behavior and body weight. It acts as a melanocortin receptor signaling antagonist, influencing appetite and metabolic balance. AGRP has multiple splice variants, adding to its regulatory complexity. Its expression extends beyond the central nervous system, with presence in tissues like the testis and placenta, indicating systemic involvement in physiological processes. AGRP Protein, Mouse (50a.a, HEK293, Fc) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The AGRP gene encodes a protein crucial for the regulation of feeding behavior and plays a key role in controlling body weight. Functioning as an antagonist of melanocortin receptor signaling, the encoded protein is involved in intricate pathways that govern appetite and metabolic balance. Multiple alternatively spliced transcript variants of this gene have been identified, contributing to the complexity of its regulatory functions. The expression of AGRP is widespread, with presence observed in various tissues, including the testis and placenta in adults, indicating its systemic involvement in physiological processes beyond the central nervous system.

Biological Activity

Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is 0.04266 µg/mL in the presence of 10 ng/mL of alpha-MSH (HY-P0252), corresponding to a specific activity is 2.344×10^4 U/mg.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P56473/NP_031453.1 (S82-T131)

Gene ID
Molecular Construction
N-term
hFc
AGRP (S82-T131)
Accession # P56473/NP_031453.1
C-term
Synonyms
Agouti-related protein; AGRP; AGRT; ART
AA Sequence

SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT

Molecular Weight

Approximately 35-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AGRP Protein, Mouse (50a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGRP Protein, Mouse (50a.a, HEK293, Fc)
Cat. No.:
HY-P75524
Quantity:
MCE Japan Authorized Agent: