1. Recombinant Proteins
  2. Receptor Proteins
  3. AGER Protein, Mouse (HEK293, His)

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGER gene encodes a protein that exhibits S100 protein binding activity, advanced glycation end-product binding activity, and heparin binding activity. Involved in various processes, including cellular response to amyloid-beta, negative regulation of long-term synaptic potentiation, and positive regulation of cytokine production, AGER acts upstream of or within pathways related to induction of positive chemotaxis, negative regulation of advanced glycation end-product receptor activity, and positive regulation of macromolecule metabolic processes. Predominantly located in the extracellular space and plasma membrane, AGER is expressed across diverse structures such as the alimentary system, brain, genitourinary system, hemolymphoid system gland, and lung. Implicated in multiple diseases, including autoimmune diseases, cardiovascular system diseases, cystic fibrosis, kidney failure, and lupus nephritis, the human ortholog of AGER, known as advanced glycosylation end-product specific receptor, plays a crucial role in diverse physiological and pathological contexts. Notably, its expression is particularly enriched in the adult lung.

Biological Activity

Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED50 for this effect is 0.6233-1.298 μg/mL.

  • Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED50 for this effect is 0.6233 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q62151-1/NP_031451.2 (Q24-A342)

Gene ID
Molecular Construction
N-term
AGER (Q24-A342)
Accession # Q62151-1/NP_031451.2
His
C-term
Protein Length

Partial

Synonyms
Advanced glycosylation end product-specific receptor; Ager; Rage
AA Sequence

QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA

Molecular Weight

Approximately 50 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AGER Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGER Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74425
Quantity:
MCE Japan Authorized Agent: