1. Recombinant Proteins
  2. Enzymes & Regulators
  3. ADTRP Protein, Human (Cell-Free, His, Myc)

ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.

Background

ADTRP protein demonstrates a specialized enzymatic function, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for FAHFAs exhibiting branching distal from the carboxylate head group. This distinctive enzymatic activity sets ADTRP apart, as it does not hydrolyze other major classes of lipids. Additionally, ADTRP plays a regulatory role in endothelial cells by influencing the expression and cell-associated anticoagulant activity of the inhibitor TFPI, as observed in in vitro settings.

Species

Human

Source

E. coli Cell-free

Tag

N-10*His;C-Myc

Accession

Q96IZ2 (M1-K230)

Gene ID

84830

Molecular Construction
N-term
10*His
ADTRP (M1-K230)
Accession # Q96IZ2
C-term
Protein Length

Full Length

Synonyms
Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP; C6orf105
AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Predicted Molecular Mass
31.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ADTRP Protein, Human (Cell-Free, His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADTRP Protein, Human (Cell-Free, His, Myc)
Cat. No.:
HY-P702207
Quantity:
MCE Japan Authorized Agent: