1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Adenosine Receptor
  5. ADORA2A Protein-VLP, Human (HEK293)

ADORA2A Protein-VLP, a receptor for adenosine, activates adenylyl cyclase through G proteins. Its direct interaction with USP4 and GAS2L2 in the cytoplasmic C-terminal domain suggests regulatory roles. Interactions with DRD4 and NECAB2 imply involvement in diverse cellular signaling pathways. ADORA2A Protein-VLP, Human (HEK293) is the recombinant human-derived ADORA2A protein-VLP, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADORA2A Protein-VLP, a receptor for adenosine, activates adenylyl cyclase through G proteins. Its direct interaction with USP4 and GAS2L2 in the cytoplasmic C-terminal domain suggests regulatory roles. Interactions with DRD4 and NECAB2 imply involvement in diverse cellular signaling pathways. ADORA2A Protein-VLP, Human (HEK293) is the recombinant human-derived ADORA2A protein-VLP, expressed by HEK293 , with tag free.

Background

The ADORA2A Protein-VLP, functioning as a receptor for adenosine, operates through G proteins to activate adenylyl cyclase. Its cytoplasmic C-terminal domain interacts directly with USP4 and GAS2L2, suggesting potential regulatory roles in cellular processes. Additionally, ADORA2A Protein-VLP may interact with DRD4 and NECAB2, further indicating its involvement in diverse cellular signaling pathways.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P29274 (M1-S412)

Gene ID

135  [NCBI]

Molecular Construction
N-term
ADORA2A-VLP (M1-S412)
Accession # P29274
C-term
Synonyms
ADORA2A; adenosine A2a receptor; ADORA2; adenosine receptor A2a; RDC8; adenosine A2 receptor; adenosine receptor subtype A2a; hA2aR;
AA Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Glycosylation
Yes
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ADORA2A Protein-VLP, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADORA2A Protein-VLP, Human (HEK293)
Cat. No.:
HY-P700899
Quantity:
MCE Japan Authorized Agent: