1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Adenosine Receptor
  5. ADORA1 Protein, Human (Cell-Free, His)

ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.

Background

The ADORA1 Protein functions as a receptor for adenosine, and its activity is mediated by G proteins that inhibit adenylyl cyclase.

Species

Human

Source

E. coli Cell-free

Tag

N-10*His

Accession

P30542 (M1-D326)

Gene ID

134

Molecular Construction
N-term
10*His
ADORA1 (M1-D326)
Accession # P30542
C-term
Protein Length

Full Length

Synonyms
Adenosine receptor A1
AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Predicted Molecular Mass
39.3 kDa
Molecular Weight

Monomer: 36 kDa; Dimer: 80 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ADORA1 Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADORA1 Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702202
Quantity:
MCE Japan Authorized Agent: