1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. Activin A Receptor Type 2B (ACVR2B)
  6. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His)

ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His)

Cat. No.: HY-P700557
Handling Instructions Technical Support

ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

ACVR2B, a transmembrane serine/threonine kinase, forms an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B, or ACVR1c), playing a crucial role in transducing activin signals across the cell membrane and regulating various physiological and pathological processes. This includes influencing neuronal differentiation and survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Activin, known to have a paracrine or autocrine role in ovarian follicular development, binds to the type-2 receptor at the plasma membrane, activating its serine-threonine kinase activity. This activated type-2 receptor then phosphorylates and activates the type-1 receptor, such as ACVR1B, leading to subsequent phosphorylation of the SMAD proteins SMAD2 and SMAD3. Once activated, SMAD2 and SMAD3, in association with the common partner SMAD4, translocate into the nucleus, where they mediate activin-induced transcription. The inhibitory SMAD7, recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, blocking the activin signal. Furthermore, the binding of inhibin-B to the receptor, facilitated by the IGSF1 inhibin coreceptor, acts as an antagonist to activin signal transduction.

In Vitro

Recombinant human ACVR2B (5 μg/mL) inhibits the effects of BMP-9 on INA-6 and IH-1 cells[2].

Species

Human; Cynomolgus

Source

P. pastoris

Tag

N-6*His

Accession

Q13705-1 (S19-T137)/XP_045242398.1 (S40-T158)

Gene ID

93  [NCBI]/102118668

Molecular Construction
N-term
6*His
ACVR2B (S19-T137)
Accession # Q13705-1
C-term
Protein Length

Extracellular Domain

Synonyms
Activin receptor type IIB; ACTR-IIB
AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Predicted Molecular Mass
15.7 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His)
Cat. No.:
HY-P700557
Quantity:
MCE Japan Authorized Agent: