1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. Activin A Receptor Type 2A (ACTR-IIA)
  6. ACVR2A/Activin RIIA Protein, Human (HEK293, C-His)

ACVR2A/Activin RIIA Protein, Human (HEK293, C-His)

Cat. No.: HY-P7455A
Handling Instructions Technical Support

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A. ACVR2A/Activin RIIA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 115 amino acids (A20-P134).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 115 amino acids (A20-P134).

Background

ACVR2A is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2].
The sequence of amino acids in ACVR2A proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ACVR2A has been only slightly altered, and that both in humans and in animals, its function is similar.
Signaling by activins and BMPs is highly promiscuous, since apart from signaling through ALK4/7, the activin type II receptors (ACVR2A and 2B) can interact also with several type I BMP receptors (ALK1/2/3/6), which can also form complexes with the type II BMP receptor, BMPRII. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ACVR2A can form complexes with different type I receptors that signal either to Smad2/3 (ALK4) or to Smad1/5/8 (ALK2, ALK3, ALK6). The different type I receptors compete for binding to ACVR2A and that this competition provides a mechanism that balances signaling between Activin A-mediated, ALK4-dependent Smad2/3 signaling, and BMP-mediated ALK2 or ALK3-dependent signaling to Smad1/5/8. In myeloma cells, BMP-6- and BMP-9-induced activation of SMAD1/5/8 through ACVR2A/ACVR2B/ALK2 is inhibited by activin A treatment[1][3].

In Vitro

Recombinant human ACVR2A (5 μg/mL) inhibits the effects of BMP-9 on INA-6 and IH-1 cells[1].
Recombinant human ACVR2A (100 μg/mL; 96 hours) blocks the β-cell-proliferative effect of adenoviruses containing mouse Pdx-1 (AdCMV-mPdx-1) treatment[4].

Biological Activity

1.Measured by its ability to neutralize Activin A inhibitory effect of murine MPC-11 cells. The ED50 this effect is 0.0487 μg/mL in the presence of 7.5 ng/mL Activin A, corresponding to a specific activity is 2.05×104 units/mg.
2.Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is <0.1 μg/mL in the presence of 10 ng/ml Recombinant Human Activin A.

  • Measured by its ability to neutralize Activin A inhibitory effect of murine MPC-11 cells. The ED50 for this effect is 0.0487 μg/ml in the presence of 7.5 ng/mL Activin A, corresponding to a specific activity is 2.05×104 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P27037-1 (A20-P134)

Gene ID

92  [NCBI]

Molecular Construction
N-term
ACVR2A (A20-P134)
Accession # P27037
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuActivin receptor type 2A, His; ACVR-2A; Activin receptor type 2A
AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPHHHHHH

Molecular Weight

Approximately 24-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR2A/Activin RIIA Protein, Human (HEK293, C-His)
Cat. No.:
HY-P7455A
Quantity:
MCE Japan Authorized Agent: