ACKR1 Protein, Human (Cell-Free, His)

ACKR3 is an atypical chemokine receptor that regulates chemokine levels and localization through high-affinity binding, induction of sequestration, degradation, or transcytosis. ACKR3, also known as a chemokine interceptor or decoy receptor, binds to chemokines such as CXCL11 and CXCL12/SDF1. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

ACKR3, an atypical chemokine receptor, serves as a key regulator of chemokine levels and localization through high-affinity binding to chemokines, leading to chemokine sequestration, degradation, or transcytosis. Also referred to as an interceptor, chemokine-scavenging receptor, or chemokine decoy receptor, ACKR3 functions as a receptor for chemokines such as CXCL11 and CXCL12/SDF1. Unlike traditional ligand-driven signal transduction, chemokine binding to ACKR3 does not activate G-protein-mediated pathways but induces beta-arrestin recruitment, resulting in ligand internalization and activation of the MAPK signaling pathway. ACKR3 plays a crucial role in regulating CXCR4 protein levels in migrating interneurons, adapting their chemokine responsiveness. In glioma cells, it transduces signals through the MEK/ERK pathway, contributing to cell growth and survival. While not involved in normal hematopoietic progenitor cell functions, ACKR3 is activated by CXCL11 in malignant hematopoietic cells, leading to ERK1/2 phosphorylation, enhanced cell adhesion, and migration. Additionally, ACKR3 acts as a coreceptor with CXCR4 for a limited subset of HIV isolates, highlighting its involvement in microbial infection.

Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 0.2 μg/well can bind human CCL2,the ED₅₀ of human CCL2 protein is ≤70 μg/ml.

Human

E. coli Cell-free

N-10*His

Q16570-1 (M1-S336)

2532  [NCBI]

Full Length of Isoform-1

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

42 kDa

Greater than 85% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% FOS12, 6% Trehalose,pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.