1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. 15-PGDH/HPGD Protein, Human (C-His)

15-PGDH/HPGD, a short-chain nonmetalloenzyme alcohol dehydrogenase, is crucial for prostaglandin metabolism, influencing various physiological and cellular processes like inflammation. Mutations lead to hypertrophic osteoarthropathy. Biased expression in urinary bladder (RPKM 176.8) and stomach (RPKM 67.9), among other tissues. Multiple isoforms arise from various transcript variants. 15-PGDH/HPGD Protein, Human (C-His) is the recombinant human-derived 15-PGDH/HPGD, expressed by E. coli, with C-6*His labeled tag. The total length of 15-PGDH/HPGD Protein, Human (C-His) is 266 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

15-PGDH/HPGD, a short-chain nonmetalloenzyme alcohol dehydrogenase, is crucial for prostaglandin metabolism, influencing various physiological and cellular processes like inflammation. Mutations lead to hypertrophic osteoarthropathy. Biased expression in urinary bladder (RPKM 176.8) and stomach (RPKM 67.9), among other tissues. Multiple isoforms arise from various transcript variants. 15-PGDH/HPGD Protein, Human (C-His) is the recombinant human-derived 15-PGDH/HPGD, expressed by E. coli, with C-6*His labeled tag. The total length of 15-PGDH/HPGD Protein, Human (C-His) is 266 a.a..

Background

15-PGDH/HPGD Protein, a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family, plays a crucial role in the metabolism of prostaglandins, contributing to various physiological and cellular processes, including inflammation. Mutations in this gene are associated with primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy, underscoring its significance in maintaining normal skeletal development. The gene exhibits multiple transcript variants, encoding different isoforms, adding to the functional diversity of the encoded enzyme. Notably, 15-PGDH/HPGD demonstrates biased expression, with heightened levels observed in the urinary bladder (RPKM 176.8), stomach (RPKM 67.9), and 11 other tissues, suggesting its specialized roles in these tissues and its potential involvement in diverse physiological contexts.

Biological Activity

Measure by the production of NADH during the oxidation of PGF2 alpha that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 1500.536 pmol/min/μg.

Assay Procedure

Materials
Assay buffer: 50 mM Tris, 100 mM NaCl, 2 mM Dithiothreitol (DTT) , pH 9.0
15-PGDH/HPGD Protein, Human (C-His) (HY-P75547A)
Substrate: β-NAD, PGF2 α

Procedure
1. Prepare the substrate mixture:
a. Dilute β-NAD to 1 mM in assay buffer.
b. Dilute PGF2 α to 0.4 mM in assay buffer.
c. Mix equal volumes of each substance to a final concentration of 0.5 mM β-NAD and 0.2 mM PGF2 α.
2. Dilute Human HPGD to 1.0 ng/μL in assay buffer.
3. The reaction was started by adding 50 μL of 1.0 ng/μL Human HPGD and 50 μL of substrate mixture to each well, and 50 μL of assay buffer and 50 μL of substrate mixture to the control group.
4. The optical density (OD) was measured at 339 nm in kinetic mode for 5 minutes using a microplate reader.
5. Calculate Specific Activity:

Specific Activity (pmol/min/μg) = Adjusted Vmax* (OD/min) × Well Volume (L) × 1012 pmol/mol
Ext. Coeff ** (M-1cm-1) × Path Corr.*** (cm) × Amount of Enzyme (μg)
*Adjusted for substrate blank (substrate blank correction)
**Extinction coefficient (abbrev.: Ext. Coeff): 6220 M-1cm-1
*** Path correction (abbrev.: Path Corr.): 0.32 cm
Per Well:
Human HPGD: 0.05 μg
β-NAD: 0.25 mM
PGF2 α: 0.1 mM

Species

Human

Source

E. coli

Tag

C-6*His

Accession

NP_000851.2 (M1-Q266)

Gene ID

3248

Protein Length

Full Length

Synonyms
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; HPGD; PGDH1; SDR36C1
AA Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Weight

Approximately 29 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10 % trehalose and 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

15-PGDH/HPGD Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
15-PGDH/HPGD Protein, Human (C-His)
Cat. No.:
HY-P75547A
Quantity:
MCE Japan Authorized Agent: