1. Recombinant Proteins
  2. Others
  3. 14-3-3 epsilon Protein, Mouse (His)

14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.

Background

The 14-3-3 epsilon protein serves as an adapter implicated in the regulation of a diverse array of both general and specialized signaling pathways, binding to numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Notably, it positively regulates the nuclear export of phosphorylated protein HSF1 to the cytoplasm. Existing as a homodimer, it also forms heterodimers with YWHAZ and interacts with various proteins, including PKA-phosphorylated AANAT, ABL1 in its phosphorylated form, ARHGEF28, BEX3, CDKN1B, the 'Thr-369' phosphorylated form of DAPK2, DENND1A, GAB2, phosphorylated GRB10, KSR1, NDEL1, PI4KB, TBC1D22A, TBC1D22B, the phosphorylated form of SRPK2, TIAM2, the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1, ZFP36, SLITRK1, HSF1 in its phosphorylated form, RIPOR2, KLHL22, CRTC1, CRTC2 (probably when phosphorylated at 'Ser-171'), CRTC3 (probably when phosphorylated at 'Ser-162' and/or 'Ser-273'), ATP2B1, ATP2B3, and MEFV. These interactions highlight the multifaceted role of 14-3-3 epsilon in orchestrating various cellular processes and signaling events.

Biological Activity

Immobilized Mouse 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.2259 μg/mL.

  • Immobilized Mouse 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.2259 μg/mL.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P62259 (M1-Q255)

Gene ID
Molecular Construction
N-term
6*His
14-3-3E (M1-Q255)
Accession # P62259
C-term
Protein Length

Full Length

Synonyms
14-3-3 protein epsilon, N-GST; YWHAE; 14-3-3E
AA Sequence

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Molecular Weight

Approximately 31 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

14-3-3 epsilon Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
14-3-3 epsilon Protein, Mouse (His)
Cat. No.:
HY-P75549
Quantity:
MCE Japan Authorized Agent: