1. Anti-infection
  2. Antibiotic
  3. BMAP-28

BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

BMAP-28 Chemical Structure

BMAP-28 Chemical Structure

CAS No. : 184870-31-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer[1].

In Vitro

BMAP-28 (3 µM; 10 min) attenuates mitochondrial calcein fluorescence in U937 cells[1].
BMAP-28 causes depolarization of the inner mitochondrial membrane in single cells and in isolated mitochondria[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Immunofluorescence[1]

Cell Line: U937 cells
Concentration: 3 µM
Incubation Time: 10 min
Result: Caused a remarkable attenuation of the calcein fluorescence.
Molecular Weight

3073.81

Formula

C145H250N44O29

CAS No.
Sequence

Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2

Sequence Shortening

GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMAP-28
Cat. No.:
HY-P5288
Quantity:
MCE Japan Authorized Agent: