1. GPCR/G Protein Neuronal Signaling
  2. Cholecystokinin Receptor
  3. Big Gastrin I (human) TFA

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Big Gastrin I (human) TFA Chemical Structure

Big Gastrin I (human) TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Cholecystokinin Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases[1].

In Vitro

Big Gastrin I, human (TFA) (10 μg/mL, 6 days) inhibits 11.3% of HBV replication in HepG2 cells containing the hepatitis B virus (HBV) ayw strain genome and maintains cell viability at 88.7%[1].
Big Gastrin I, human (TFA) (10 μg/mL, 24 h) can arrest cells mainly in G0/G1 phase and induces apoptosis in human A549 cells[1].
Big Gastrin I, human (TFA) (10 μg/mL, 22 h) can inhibit 35% of cell migration in human endothelial cells (HUVEC)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Cycle Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Resulted in 55.9% cells stalled in G0/G1 phase, 34.1% cells stalled in S phase and 10% cells stalled in G2/M phase.

Apoptosis Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Induced 1.1% cells apoptosis.
Molecular Weight

3963.21

Formula

C178H252F3

Sequence Shortening

{Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Big Gastrin I (human) TFA
Cat. No.:
HY-P3446A
Quantity:
MCE Japan Authorized Agent: