β-Amyloid (42-1), human TFA (Synonyms: Amyloid β Peptide (42-1)(human) TFA)

Cat. No.: HY-P1362A: Data Sheet
SDS
Handling Instructions
FAQs
Technical Support

β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

For research use only. We do not sell to patients.

β-Amyloid (42-1), human TFA Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of β-Amyloid (42-1), human TFA:

β-Amyloid (42-1), human

Other Forms of β-Amyloid (42-1), human TFA:

β-Amyloid (42-1), human In-stock

1 Publications Citing Use of MCE β-Amyloid (42-1), human TFA

•Neurochem Res. 2025 Apr 4;50(2):135. [Abstract]

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vivo

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Appearance

Solid

Color

White to off-white

Sequence Shortening

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Purity & Documentation

Data Sheet (264 KB) SDS (252 KB) Handling Instructions (2659 KB)

References

[1]. Schilling T, et al. Amyloid-β-induced reactive oxygen species production and priming are differentially regulated by ion channels in microglia. J Cell Physiol. 2011 Dec;226(12):3295-302. [Content Brief]

β-Amyloid (42-1), human TFA Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

β-Amyloid (42-1), humanAmyloid β Peptide (42-1)(human)Amyloid-ββ-amyloid peptideAβAbetaAlzheimer diseaseInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *