1. Peptides
  2. Peptide and Derivatives
  3. Peptides for Drug Delivery
  4. Cell-penetrating Peptides
  5. Tat-peptide 190-208

Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Tat-peptide 190-208 Chemical Structure

Tat-peptide 190-208 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Tat-peptide 190-208:

Other Forms of Tat-peptide 190-208:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms[1].

In Vitro

Tat-peptide 190-208 (10 μM, 20 μM; 24 h) increases axon length in dissociated DRG cultures with 10 μM, as well as in iMotor neurons with 20 μM[1].
Tat-peptide 190-208 (10 μM; 3 d) increases the overall number of neurites extended from each neuron[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3393.45

Formula

C142H214N40O57

Sequence

Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn-Val-Ala-Glu-Pro-Glu-Pro-Asp-Pro-Glu-Pro-Glu-Pro-Glu-Gln-Glu-Pro-Val-Ser-Glu

Sequence Shortening

YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tat-peptide 190-208
Cat. No.:
HY-P5118
Quantity:
MCE Japan Authorized Agent: