MIP-1-alpha

By Targets:	CCR (8) Drug Derivative (1) HIV (3) Small Interfering RNA (siRNA) (2)
By Research Areas:	Cancer (4) Endocrinology (2) Infection (3) Inflammation/Immunology (5) Neurological Disease (1)
Oligonucleotides:	Mouse Pre-designed siRNA Sets (1) Human Pre-designed siRNA Sets (1) siRNAs (2)

Targets Recommended: 5 alpha Reductase IFNAR α-synuclein PGC-1α

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-19974

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits *HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV*-1 HHA) in PBMCs.

HY-RS02099

CCL3 Human Pre-designed siRNA Set A SCI; LD78; MIP1A; SCYA3; G0S19-1; LD78alpha; MIP-1-alpha	Small Interfering RNA (siRNA)	Others
CCL3 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

CCL3 Human Pre-designed siRNA Set A CCL3 Human Pre-designed siRNA Set A

HY-RS16642

Ccl3 Mouse Pre-designed siRNA Set A MIP1a; Scya3; G0S19-1; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha	Small Interfering RNA (siRNA)	Others
Ccl3 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccl3 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

Ccl3 Mouse Pre-designed siRNA Set A Ccl3 Mouse Pre-designed siRNA Set A

HY-P3627

Nagrestipen	Drug Derivative	Cancer
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis ^[1].

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-B0155

Vicriviroc SCH 417690; SCH-D; MK-7690 free base	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer ^[1] .

HY-B0155B

Vicriviroc malate SCH 417690 malate; SCH-D malate; MK-7690	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer ^[1] .

HY-15544

CCR1 antagonist 10	CCR	Inflammation/Immunology
CCR1 antagonist 10 (example 1) is a potent and orally active *CCR1* antagonist. CCR1 antagonist 10 inhibits ¹²⁵I-MIP-1α binding to THP-1 cell membranes with an K_i value of 2.3 nM ^[1].

HY-103360B

trans-J-113863	CCR	Inflammation/Immunology
trans-J-113863 is a potent chemokine *CCR1* and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC₅₀ of 9.57 and 93.8 nM,respectively ^[1] .

HY-B0498

Bindarit 15+ Cited Publications AF2838	CCR	Neurological Disease Inflammation/Immunology Endocrinology Cancer
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1*β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

Cat. No.	Product Name	Target	Research Area

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-P3627

Nagrestipen	Drug Derivative	Cancer
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis ^[1].

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-B0498

Bindarit 15+ Cited Publications AF2838	Structural Classification Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Umbelliferae Plants Disease Research Fields Echinacea angustifolia DC. Endocrinology Cancer	CCR
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1*β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

Species:	Human (2) Rat (1) Mouse (2)
Tag:	His (1) Tag Free (4)
Source:	HEK293 (1) CHO (1) E. coli (3)

Cat. No.	Compare	Product Name	Species	Source

HY-P71898

	MIP-1 alpha/CCL3 Protein, Rat Ccl3; MIP1a; Scya3; C-C motif chemokine 3; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; Small-inducible cytokine A3	Rat	E. coli
	The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

HY-P7768

	MIP-1 alpha/CCL3 Protein, Mouse (His) 1 Publications Verification rMuCCL3, His; C-C motif chemokine 3; Heparin-binding chemotaxis protein; LD78 alpha; MIP-1 alpha; SCYA3; CCL3	Mouse	E. coli
	MIP-1 alpha/CCL3 Protein, Mouse (His), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (His) is a recombinant mouse CCL3 (A24-A92) expressed by E.coil with a N-6*His tag.

HY-P7254

	MIP-1 alpha/CCL3 Protein, Human (CHO) rHuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Human	CHO
	MIP-1 alpha/CCL3 Protein, Human (CHO), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human (CHO) is a recombinant human CCL3 (A27-A92) expressed by CHO.

HY-P7255

	MIP-1 alpha/CCL3 Protein, Mouse (HEK293) 3 Publications Verification rMuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Mouse	HEK293
	MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293.

HY-P7256

	MIP-1 alpha/CCL3 Protein, Human rHuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Human	E. coli
	MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name		Classification

HY-RS02099

CCL3 Human Pre-designed siRNA Set A SCI; LD78; MIP1A; SCYA3; G0S19-1; LD78alpha; MIP-1-alpha		siRNAs Human Pre-designed siRNA Sets
CCL3 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

HY-RS16642

Ccl3 Mouse Pre-designed siRNA Set A MIP1a; Scya3; G0S19-1; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha		siRNAs Mouse Pre-designed siRNA Sets
Ccl3 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccl3 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Natural
Products

Recombinant Proteins

Oligonucleotides

Name
Email *

	Sorry, but the email address you supplied was invalid.

MIP-1-alpha

Inhibitors & Agonists

Peptides

NaturalProducts

Recombinant Proteins

Oligonucleotides

Natural
Products